SCOPe 2.01: Domain d1ymsb_: 1yms B:

Lineage for d1ymsb_ (1yms B:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (13 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (27 PDB entries)

8. Domain d1ymsb_: 1yms B: [162256]
   automated match to d1iysa_
   complexed with nbf

Details for d1ymsb_

PDB Entry: 1yms, 1.6 Å

PDB Description: X-ray crystallographic structure of CTX-M-9 beta-lactamase complexed with nafcinin-like boronic acid inhibitor

PDB Compounds: (B:) beta-lactamase CTX-M-9

SCOPe Domain Sequences for d1ymsb_:

Sequence; same for both SEQRES and ATOM records:

>d1ymsb_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
savqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetq
kqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpgg
vtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraql
vtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftqpq
qnaesrrdvlasaariiaegl

Timeline for d1ymsb_:

• d1ymsb_ is new in SCOPe 2.01-stable
  
• d1ymsb_ appears in SCOPe 2.02
  
• d1ymsb_ appears in the current release, SCOPe 2.08