Lineage for d1ymsb_ (1yms B:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1054405Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1054945Protein automated matches [190161] (13 species)
    not a true protein
  7. 1054971Species Escherichia coli [TaxId:562] [187306] (27 PDB entries)
  8. 1055002Domain d1ymsb_: 1yms B: [162256]
    automated match to d1iysa_
    complexed with nbf

Details for d1ymsb_

PDB Entry: 1yms (more details), 1.6 Å

PDB Description: X-ray crystallographic structure of CTX-M-9 beta-lactamase complexed with nafcinin-like boronic acid inhibitor
PDB Compounds: (B:) beta-lactamase CTX-M-9

SCOPe Domain Sequences for d1ymsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ymsb_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
savqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetq
kqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpgg
vtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraql
vtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftqpq
qnaesrrdvlasaariiaegl

SCOPe Domain Coordinates for d1ymsb_:

Click to download the PDB-style file with coordinates for d1ymsb_.
(The format of our PDB-style files is described here.)

Timeline for d1ymsb_: