SCOP 1.67: Domain d1b59a1: 1b59 A:375-448

Lineage for d1b59a1 (1b59 A:375-448)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
   circularly permuted version of the "winged helix" fold

6. Protein Methionine aminopeptidase, insert domain [46888] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46890] (7 PDB entries)

8. Domain d1b59a1: 1b59 A:375-448 [16225]
   Other proteins in same PDB: d1b59a2

Details for d1b59a1

PDB Entry: 1b59, 1.8 Å

PDB Description: complex of human methionine aminopeptidase-2 complexed with ovalicin

SCOP Domain Sequences for d1b59a1:

Sequence; same for both SEQRES and ATOM records:

>d1b59a1 a.4.5.25 (A:375-448) Methionine aminopeptidase, insert domain {Human (Homo sapiens)}
hddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskylmalkn
lcdlgivdpypplc

Timeline for d1b59a1:

• d1b59a1 first appeared (with stable ids) in SCOP 1.55
  
• d1b59a1 appears in SCOP 1.65
  
• d1b59a1 appears in SCOP 1.69
  
• d1b59a1 appears in the current release, SCOPe 2.08