Lineage for d1b59a1 (1b59 A:375-448)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 95173Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (32 families) (S)
  5. 95463Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
  6. 95464Protein Methionine aminopeptidase, insert domain [46888] (2 species)
  7. 95473Species Human (Homo sapiens) [TaxId:9606] [46890] (4 PDB entries)
  8. 95476Domain d1b59a1: 1b59 A:375-448 [16225]
    Other proteins in same PDB: d1b59a2

Details for d1b59a1

PDB Entry: 1b59 (more details), 1.8 Å

PDB Description: complex of human methionine aminopeptidase-2 complexed with ovalicin

SCOP Domain Sequences for d1b59a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b59a1 a.4.5.25 (A:375-448) Methionine aminopeptidase, insert domain {Human (Homo sapiens)}
hddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskylmalkn
lcdlgivdpypplc

SCOP Domain Coordinates for d1b59a1:

Click to download the PDB-style file with coordinates for d1b59a1.
(The format of our PDB-style files is described here.)

Timeline for d1b59a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b59a2