SCOP 1.57: Domain d1b59a1: 1b59 A:375-448

Lineage for d1b59a1 (1b59 A:375-448)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families)

5. Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)

6. Protein Methionine aminopeptidase, insert domain [46888] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46890] (4 PDB entries)

8. Domain d1b59a1: 1b59 A:375-448 [16225]
   Other proteins in same PDB: d1b59a2

Details for d1b59a1

PDB Entry: 1b59, 1.8 Å

PDB Description: complex of human methionine aminopeptidase-2 complexed with ovalicin

SCOP Domain Sequences for d1b59a1:

Sequence; same for both SEQRES and ATOM records:

>d1b59a1 a.4.5.25 (A:375-448) Methionine aminopeptidase, insert domain {Human (Homo sapiens)}
hddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskylmalkn
lcdlgivdpypplc

Timeline for d1b59a1:

• d1b59a1 first appeared (with stable ids) in SCOP 1.55
  
• d1b59a1 appears in SCOP 1.59
  
• d1b59a1 appears in the current release, SCOPe 2.08