Lineage for d1ylta_ (1ylt A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1054405Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1054945Protein automated matches [190161] (13 species)
    not a true protein
  7. 1054971Species Escherichia coli [TaxId:562] [187306] (27 PDB entries)
  8. 1054977Domain d1ylta_: 1ylt A: [162242]
    automated match to d1iysa_
    complexed with so4, suc

Details for d1ylta_

PDB Entry: 1ylt (more details), 1.1 Å

PDB Description: atomic resolution structure of ctx-m-14 beta-lactamase
PDB Compounds: (A:) beta-lactamase CTX-M-14

SCOPe Domain Sequences for d1ylta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylta_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
qlvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftq
pqqnaesrrdvlasaariiaegl

SCOPe Domain Coordinates for d1ylta_:

Click to download the PDB-style file with coordinates for d1ylta_.
(The format of our PDB-style files is described here.)

Timeline for d1ylta_: