Lineage for d1xgmb1 (1xgm B:195-271)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 95173Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (32 families) (S)
  5. 95463Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
  6. 95464Protein Methionine aminopeptidase, insert domain [46888] (2 species)
  7. 95465Species Archaeon Pyrococcus furiosus [TaxId:2261] [46889] (4 PDB entries)
  8. 95471Domain d1xgmb1: 1xgm B:195-271 [16221]
    Other proteins in same PDB: d1xgma2, d1xgmb2

Details for d1xgmb1

PDB Entry: 1xgm (more details), 2.8 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus

SCOP Domain Sequences for d1xgmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgmb1 a.4.5.25 (B:195-271) Methionine aminopeptidase, insert domain {Archaeon Pyrococcus furiosus}
gqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwlqndmpegqlklalk
tlekagaiygypvlkei

SCOP Domain Coordinates for d1xgmb1:

Click to download the PDB-style file with coordinates for d1xgmb1.
(The format of our PDB-style files is described here.)

Timeline for d1xgmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xgmb2