SCOP 1.55: Domain d1xgmb1: 1xgm B:195-271

Lineage for d1xgmb1 (1xgm B:195-271)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families)

5. Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)

6. Protein Methionine aminopeptidase, insert domain [46888] (2 species)

7. Species Pyrococcus furiosus [TaxId:186497] [46889] (4 PDB entries)

8. Domain d1xgmb1: 1xgm B:195-271 [16221]
   Other proteins in same PDB: d1xgma2, d1xgmb2

Details for d1xgmb1

PDB Entry: 1xgm, 2.8 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus

SCOP Domain Sequences for d1xgmb1:

Sequence; same for both SEQRES and ATOM records:

>d1xgmb1 a.4.5.25 (B:195-271) Methionine aminopeptidase, insert domain {Pyrococcus furiosus}
gqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwlqndmpegqlklalk
tlekagaiygypvlkei

Timeline for d1xgmb1:

• d1xgmb1 appears in SCOP 1.57
  
• d1xgmb1 appears in the current release, SCOPe 2.08