Lineage for d1c0wb1 (1c0w B:2-64)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306994Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
    automatically mapped to Pfam PF01325
  6. 2306995Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)
  7. 2306996Species Corynebacterium diphtheriae [TaxId:1717] [46884] (20 PDB entries)
    Uniprot P33120
  8. 2307027Domain d1c0wb1: 1c0w B:2-64 [16212]
    Other proteins in same PDB: d1c0wa2, d1c0wa3, d1c0wb2, d1c0wb3, d1c0wc2, d1c0wc3, d1c0wd2, d1c0wd3
    protein/DNA complex; complexed with co

Details for d1c0wb1

PDB Entry: 1c0w (more details), 3.2 Å

PDB Description: crystal structure of the cobalt-activated diphtheria toxin repressor-dna complex reveals a metal binding sh-like domain
PDB Compounds: (B:) diphtheria toxin repressor

SCOPe Domain Sequences for d1c0wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0wb1 a.4.5.24 (B:2-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
lqm

SCOPe Domain Coordinates for d1c0wb1:

Click to download the PDB-style file with coordinates for d1c0wb1.
(The format of our PDB-style files is described here.)

Timeline for d1c0wb1: