SCOP 1.55: Domain d1c0wb1: 1c0w B:2-64

Lineage for d1c0wb1 (1c0w B:2-64)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families)

5. Family a.4.5.24: Iron-dependent represor protein [46882] (2 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [46884] (10 PDB entries)

8. Domain d1c0wb1: 1c0w B:2-64 [16212]
   Other proteins in same PDB: d1c0wa2, d1c0wa3, d1c0wb2, d1c0wb3, d1c0wc2, d1c0wc3, d1c0wd2, d1c0wd3

Details for d1c0wb1

PDB Entry: 1c0w, 3.2 Å

PDB Description: crystal structure of the cobalt-activated diphtheria toxin repressor-dna complex reveals a metal binding sh-like domain

SCOP Domain Sequences for d1c0wb1:

Sequence; same for both SEQRES and ATOM records:

>d1c0wb1 a.4.5.24 (B:2-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
lqm

Timeline for d1c0wb1:

• d1c0wb1 appears in SCOP 1.57
  
• d1c0wb1 appears in the current release, SCOPe 2.08