Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins) automatically mapped to Pfam PF01325 |
Protein Diphtheria toxin repressor (DtxR) [46883] (1 species) |
Species Corynebacterium diphtheriae [TaxId:1717] [46884] (20 PDB entries) Uniprot P33120 |
Domain d1c0wb1: 1c0w B:2-64 [16212] Other proteins in same PDB: d1c0wa2, d1c0wa3, d1c0wb2, d1c0wb3, d1c0wc2, d1c0wc3, d1c0wd2, d1c0wd3 protein/DNA complex; complexed with co |
PDB Entry: 1c0w (more details), 3.2 Å
SCOPe Domain Sequences for d1c0wb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c0wb1 a.4.5.24 (B:2-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs lqm
Timeline for d1c0wb1: