Class a: All alpha proteins [46456] (226 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) contains a small beta-sheet (wing) |
Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins) |
Protein Diphtheria toxin repressor (DtxR) [46883] (1 species) |
Species Corynebacterium diphtheriae [TaxId:1717] [46884] (16 PDB entries) |
Domain d1f5td1: 1f5t D:4002-4064 [16206] Other proteins in same PDB: d1f5ta2, d1f5tb2, d1f5tc2, d1f5td2 protein/DNA complex; complexed with ni; mutant |
PDB Entry: 1f5t (more details), 3 Å
SCOP Domain Sequences for d1f5td1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f5td1 a.4.5.24 (D:4002-4064) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae} kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs lqm
Timeline for d1f5td1: