Class a: All alpha proteins [46456] (226 folds) |
Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) |
Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins) |
Protein Diphtheria toxin repressor (DtxR) [47981] (1 species) |
Species Corynebacterium diphtheriae [TaxId:1717] [47982] (16 PDB entries) |
Domain d1f5ta2: 1f5t A:1065-1121 [18409] Other proteins in same PDB: d1f5ta1, d1f5tb1, d1f5tc1, d1f5td1 |
PDB Entry: 1f5t (more details), 3 Å
SCOP Domain Sequences for d1f5ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f5ta2 a.76.1.1 (A:1065-1121) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae} tptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlk
Timeline for d1f5ta2: