| Class a: All alpha proteins [46456] (226 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins) |
| Protein Diphtheria toxin repressor (DtxR) [46883] (1 species) |
| Species Corynebacterium diphtheriae [TaxId:1717] [46884] (16 PDB entries) |
| Domain d1bi3b1: 1bi3 B:4-64 [16200] Other proteins in same PDB: d1bi3a2, d1bi3a3, d1bi3b2 complexed with so4, zn |
PDB Entry: 1bi3 (more details), 2.4 Å
SCOP Domain Sequences for d1bi3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bi3b1 a.4.5.24 (B:4-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
lvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrslq
m
Timeline for d1bi3b1: