Lineage for d1bi3a2 (1bi3 A:65-140)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540561Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 540562Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) (S)
  5. 540563Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)
  6. 540564Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 540565Species Corynebacterium diphtheriae [TaxId:1717] [47982] (16 PDB entries)
  8. 540575Domain d1bi3a2: 1bi3 A:65-140 [18405]
    Other proteins in same PDB: d1bi3a1, d1bi3a3, d1bi3b1

Details for d1bi3a2

PDB Entry: 1bi3 (more details), 2.4 Å

PDB Description: structure of apo-and holo-diphtheria toxin repressor

SCOP Domain Sequences for d1bi3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bi3a2 a.76.1.1 (A:65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv

SCOP Domain Coordinates for d1bi3a2:

Click to download the PDB-style file with coordinates for d1bi3a2.
(The format of our PDB-style files is described here.)

Timeline for d1bi3a2: