SCOP 1.67: Domain d1bi2b1: 1bi2 B:3-64

Lineage for d1bi2b1 (1bi2 B:3-64)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [46884] (15 PDB entries)

8. Domain d1bi2b1: 1bi2 B:3-64 [16198]
   Other proteins in same PDB: d1bi2a2, d1bi2a3, d1bi2b2

Details for d1bi2b1

PDB Entry: 1bi2, 2.3 Å

PDB Description: structure of apo-and holo-diphtheria toxin repressor

SCOP Domain Sequences for d1bi2b1:

Sequence; same for both SEQRES and ATOM records:

>d1bi2b1 a.4.5.24 (B:3-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
dlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl
qm

Timeline for d1bi2b1:

• d1bi2b1 first appeared (with stable ids) in SCOP 1.55
  
• d1bi2b1 appears in SCOP 1.65
  
• d1bi2b1 appears in SCOP 1.69
  
• d1bi2b1 appears in the current release, SCOPe 2.08