Lineage for d1dprb1 (1dpr B:3-64)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 533238Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) (S)
    contains a small beta-sheet (wing)
  5. 533572Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins)
  6. 533573Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)
  7. 533574Species Corynebacterium diphtheriae [TaxId:1717] [46884] (16 PDB entries)
  8. 533599Domain d1dprb1: 1dpr B:3-64 [16195]
    Other proteins in same PDB: d1dpra2, d1dprb2

Details for d1dprb1

PDB Entry: 1dpr (more details), 3 Å

PDB Description: structures of the apo-and metal ion activated forms of the diphtheria tox repressor from corynebacterium diphtheriae

SCOP Domain Sequences for d1dprb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dprb1 a.4.5.24 (B:3-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
dlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl
qm

SCOP Domain Coordinates for d1dprb1:

Click to download the PDB-style file with coordinates for d1dprb1.
(The format of our PDB-style files is described here.)

Timeline for d1dprb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dprb2