Lineage for d1dprb2 (1dpr B:65-136)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540561Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 540562Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) (S)
  5. 540563Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)
  6. 540564Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 540565Species Corynebacterium diphtheriae [TaxId:1717] [47982] (16 PDB entries)
  8. 540590Domain d1dprb2: 1dpr B:65-136 [18401]
    Other proteins in same PDB: d1dpra1, d1dprb1

Details for d1dprb2

PDB Entry: 1dpr (more details), 3 Å

PDB Description: structures of the apo-and metal ion activated forms of the diphtheria tox repressor from corynebacterium diphtheriae

SCOP Domain Sequences for d1dprb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dprb2 a.76.1.1 (B:65-136) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs
rspfgnpipgld

SCOP Domain Coordinates for d1dprb2:

Click to download the PDB-style file with coordinates for d1dprb2.
(The format of our PDB-style files is described here.)

Timeline for d1dprb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dprb1