Lineage for d1w7ua_ (1w7u A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. Protein automated matches [190406] (19 species)
    not a true protein
  7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (56 PDB entries)
  8. Domain d1w7ua_: 1w7u A: [161915]
    automated match to d1hcjc_

Details for d1w7ua_

PDB Entry: 1w7u (more details), 1.85 Å

PDB Description: photoproduct of the wild-type aequorea victoria green fluorescent protein after structural annealing at 170k
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d1w7ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7ua_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllafvtaagith

SCOPe Domain Coordinates for d1w7ua_ are not available.

Timeline for d1w7ua_:

Domains from other chains:
(mouse over for more information)
d1w7ub_, d1w7uc_, d1w7ud_