Lineage for d1vbla_ (1vbl A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422942Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2422943Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2423120Family b.80.1.0: automated matches [191490] (1 protein)
    not a true family
  6. 2423121Protein automated matches [190791] (5 species)
    not a true protein
  7. 2423135Species Bacillus sp. [TaxId:132676] [188047] (1 PDB entry)
  8. 2423136Domain d1vbla_: 1vbl A: [161841]
    automated match to d1bn8a_
    complexed with ca

Details for d1vbla_

PDB Entry: 1vbl (more details), 1.91 Å

PDB Description: Structure of the thermostable pectate lyase PL 47
PDB Compounds: (A:) pectate lyase 47

SCOPe Domain Sequences for d1vbla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbla_ b.80.1.0 (A:) automated matches {Bacillus sp. [TaxId: 132676]}
kelghevlkpydgwaaygegttggamaspqnvfvvtnrteliqalggnnhtnqynsvpki
iyvkgtidlnvddnnqpvgpdfykdphfdfeaylreydpatwgkkevegpleearvrsqk
kqkdrimvyvgsntsiigvgkdakikgggfliknvdnviirniefeapldyfpewdptdg
tlgewnseydsisiegsshiwidhntftdgdhpdrslgtyfgrpfqqhdgaldiknssdf
itisynvftnhdkvtligasdsrmadsghlrvtlhhnyyknvtqrlprvrfgqvhiynny
yefsnladydfqyawgvgvfsqiyaqnnyfsfdwdidpsliikvwskneesmyetgtivd
lpngrryidlvasynesntlqlkkevtwkpmfyhvihptpsvpalvkakagagnlh

SCOPe Domain Coordinates for d1vbla_:

Click to download the PDB-style file with coordinates for d1vbla_.
(The format of our PDB-style files is described here.)

Timeline for d1vbla_: