Class b: All beta proteins [48724] (178 folds) |
Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.1: Pectin lyase-like [51126] (12 families) superhelix turns are made of 3 strands each |
Family b.80.1.0: automated matches [191490] (1 protein) not a true family |
Protein automated matches [190791] (5 species) not a true protein |
Species Bacillus sp. [TaxId:132676] [188047] (1 PDB entry) |
Domain d1vbla_: 1vbl A: [161841] automated match to d1bn8a_ complexed with ca |
PDB Entry: 1vbl (more details), 1.91 Å
SCOPe Domain Sequences for d1vbla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vbla_ b.80.1.0 (A:) automated matches {Bacillus sp. [TaxId: 132676]} kelghevlkpydgwaaygegttggamaspqnvfvvtnrteliqalggnnhtnqynsvpki iyvkgtidlnvddnnqpvgpdfykdphfdfeaylreydpatwgkkevegpleearvrsqk kqkdrimvyvgsntsiigvgkdakikgggfliknvdnviirniefeapldyfpewdptdg tlgewnseydsisiegsshiwidhntftdgdhpdrslgtyfgrpfqqhdgaldiknssdf itisynvftnhdkvtligasdsrmadsghlrvtlhhnyyknvtqrlprvrfgqvhiynny yefsnladydfqyawgvgvfsqiyaqnnyfsfdwdidpsliikvwskneesmyetgtivd lpngrryidlvasynesntlqlkkevtwkpmfyhvihptpsvpalvkakagagnlh
Timeline for d1vbla_: