SCOPe 2.01: Domain d1upms_: 1upm S:

Lineage for d1upms_ (1upm S:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)

8. Domain d1upms_: 1upm S: [161817]
   automated match to d1aa1c_
   complexed with ca, cap

Details for d1upms_

PDB Entry: 1upm, 2.3 Å

PDB Description: activated spinach rubisco complexed with 2-carboxyarabinitol 2 bisphosphat and ca2+.

PDB Compounds: (S:) ribulose bisphosphate carboxylase small chain

SCOPe Domain Sequences for d1upms_:

Sequence; same for both SEQRES and ATOM records:

>d1upms_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

Timeline for d1upms_:

• d1upms_ is new in SCOPe 2.01-stable
  
• d1upms_ appears in SCOPe 2.02
  
• d1upms_ appears in the current release, SCOPe 2.08