| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) ![]() |
| Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species) |
| Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries) |
| Domain d1upmm_: 1upm M: [161815] automated match to d1aa1c_ complexed with ca, cap |
PDB Entry: 1upm (more details), 2.3 Å
SCOPe Domain Sequences for d1upmm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1upmm_ d.73.1.1 (M:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy
Timeline for d1upmm_: