Lineage for d1upmc_ (1upm C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957671Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2957672Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species)
  7. 2957754Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)
  8. 2957783Domain d1upmc_: 1upm C: [161812]
    Other proteins in same PDB: d1upmb1, d1upmb2, d1upme1, d1upme2, d1upmh1, d1upmh2, d1upmk1, d1upmk2, d1upml1, d1upml2, d1upmo1, d1upmo2, d1upmr1, d1upmr2, d1upmv1, d1upmv2
    automated match to d1aa1c_
    complexed with ca, cap

Details for d1upmc_

PDB Entry: 1upm (more details), 2.3 Å

PDB Description: activated spinach rubisco complexed with 2-carboxyarabinitol 2 bisphosphat and ca2+.
PDB Compounds: (C:) ribulose bisphosphate carboxylase small chain

SCOPe Domain Sequences for d1upmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upmc_ d.73.1.1 (C:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOPe Domain Coordinates for d1upmc_:

Click to download the PDB-style file with coordinates for d1upmc_.
(The format of our PDB-style files is described here.)

Timeline for d1upmc_: