Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) |
Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species) |
Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries) |
Domain d1upmc_: 1upm C: [161812] Other proteins in same PDB: d1upmb1, d1upmb2, d1upme1, d1upme2, d1upmh1, d1upmh2, d1upmk1, d1upmk2, d1upml1, d1upml2, d1upmo1, d1upmo2, d1upmr1, d1upmr2, d1upmv1, d1upmv2 automated match to d1aa1c_ complexed with ca, cap |
PDB Entry: 1upm (more details), 2.3 Å
SCOPe Domain Sequences for d1upmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1upmc_ d.73.1.1 (C:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]} mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp agy
Timeline for d1upmc_: