SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1upmr2 (1upm R:148-475)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088460Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2088461Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 protein domains)
    N-terminal domain is alpha+beta
  6. 2088462Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 2088560Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (11 PDB entries)
  8. 2088603Domain d1upmr2: 1upm R:148-475 [197568]
    Other proteins in same PDB: d1upmb1, d1upmc_, d1upme1, d1upmf_, d1upmh1, d1upmi_, d1upmk1, d1upml1, d1upmm_, d1upmo1, d1upmp_, d1upmr1, d1upms_, d1upmt_, d1upmv1, d1upmw_
    automated match to d8ruca1
    complexed with ca, cap

Details for d1upmr2

PDB Entry: 1upm (more details), 2.3 Å

PDB Description: activated spinach rubisco complexed with 2-carboxyarabinitol 2 bisphosphat and ca2+.
PDB Compounds: (R:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1upmr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upmr2 c.1.14.1 (R:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwkeikfefpamdtv

SCOPe Domain Coordinates for d1upmr2:

Click to download the PDB-style file with coordinates for d1upmr2.
(The format of our PDB-style files is described here.)

Timeline for d1upmr2: