![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species) |
![]() | Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (11 PDB entries) |
![]() | Domain d1upmh1: 1upm H:9-147 [197559] Other proteins in same PDB: d1upmb2, d1upmc_, d1upme2, d1upmf_, d1upmh2, d1upmi_, d1upmk2, d1upml2, d1upmm_, d1upmo2, d1upmp_, d1upmr2, d1upms_, d1upmt_, d1upmv2, d1upmw_ automated match to d8ruca2 complexed with ca, cap |
PDB Entry: 1upm (more details), 2.3 Å
SCOPe Domain Sequences for d1upmh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1upmh1 d.58.9.1 (H:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]} asvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk alralrledlripvayvkt
Timeline for d1upmh1: