Lineage for d2stwa_ (2stw A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149792Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 150081Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (35 families) (S)
  5. 150274Family a.4.5.21: ets domain [46859] (6 proteins)
  6. 150279Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species)
  7. 150280Species Human (Homo sapiens) [TaxId:9606] [46864] (2 PDB entries)
  8. 150282Domain d2stwa_: 2stw A: [16164]

Details for d2stwa_

PDB Entry: 2stw (more details)

PDB Description: solution nmr structure of the human ets1/dna complex, restrained regularized mean structure

SCOP Domain Sequences for d2stwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2stwa_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens)}
vipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrk
nkpkmnyeklsrglryyydkniihktagkryvyrfv

SCOP Domain Coordinates for d2stwa_:

Click to download the PDB-style file with coordinates for d2stwa_.
(The format of our PDB-style files is described here.)

Timeline for d2stwa_: