SCOPe 2.04: Domain d2stta_: 2stt A:

Lineage for d2stta_ (2stt A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (9 proteins)

6. Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46864] (3 PDB entries)

8. Domain d2stta_: 2stt A: [16163]
   protein/DNA complex

Details for d2stta_

PDB Entry: 2stt

PDB Description: solution nmr structure of the human ets1/dna complex, 25 structures

PDB Compounds: (A:) ets1

SCOPe Domain Sequences for d2stta_:

Sequence; same for both SEQRES and ATOM records:

>d2stta_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens) [TaxId: 9606]}
vipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrk
nkpkmnyeklsrglryyydkniihktagkryvyrfv

Timeline for d2stta_:

• d2stta_ first appeared (with stable ids) in SCOP 1.55
  
• d2stta_ appears in SCOPe 2.03
  
• d2stta_ appears in SCOPe 2.05
  
• d2stta_ appears in the current release, SCOPe 2.08