SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2stta_ (2stt A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982648Family a.4.5.21: ets domain [46859] (9 protein domains)
  6. 1982656Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species)
  7. 1982657Species Human (Homo sapiens) [TaxId:9606] [46864] (3 PDB entries)
  8. 1982660Domain d2stta_: 2stt A: [16163]
    protein/DNA complex

Details for d2stta_

PDB Entry: 2stt (more details)

PDB Description: solution nmr structure of the human ets1/dna complex, 25 structures
PDB Compounds: (A:) ets1

SCOPe Domain Sequences for d2stta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2stta_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens) [TaxId: 9606]}
vipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrk
nkpkmnyeklsrglryyydkniihktagkryvyrfv

SCOPe Domain Coordinates for d2stta_:

Click to download the PDB-style file with coordinates for d2stta_.
(The format of our PDB-style files is described here.)

Timeline for d2stta_: