| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.21: ets domain [46859] (9 proteins) |
| Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [46864] (3 PDB entries) |
| Domain d2stta_: 2stt A: [16163] protein/DNA complex has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2stt (more details)
SCOPe Domain Sequences for d2stta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2stta_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens) [TaxId: 9606]}
vipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrk
nkpkmnyeklsrglryyydkniihktagkryvyrfv
Timeline for d2stta_: