Lineage for d1flia_ (1fli A:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (35 families) 
Family a.4.5.21: ets domain [46859] (6 proteins) 
Protein Fli-1 [46860] (1 species) Species Human (Homo sapiens) [TaxId:9606] [46861] (1 PDB entry) 
Domain d1flia_: 1fli A: [16160]
Details for d1flia_
PDB Entry: 1fli (more details)
PDB Description: dna-binding domain of fli-1
SCOP Domain Sequences for d1flia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1flia_ a.4.5.21 (A:) Fli-1 {Human (Homo sapiens)}
pgsgqiqlwqfllellsdsanascitwegtngefkmtdpdevarrwgerkskpnmnydkl
sralryyydknimtkvhgkryaykfdfhgiaqalqphp
SCOP Domain Coordinates for d1flia_:
Click to download the PDB-style file with coordinates for d1flia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1flia_:
- d1flia_ first appeared (with stable ids) in SCOP 1.55
- d1flia_ appears in SCOP 1.59
- d1flia_ appears in SCOP 1.63
- d1flia_ appears in the current release, SCOPe 2.08
View in 3D