Lineage for d1flia_ (1fli A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693426Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 2693452Protein Fli-1 [46860] (1 species)
  7. 2693453Species Human (Homo sapiens) [TaxId:9606] [46861] (1 PDB entry)
  8. 2693454Domain d1flia_: 1fli A: [16160]

Details for d1flia_

PDB Entry: 1fli (more details)

PDB Description: dna-binding domain of fli-1
PDB Compounds: (A:) fli-1

SCOPe Domain Sequences for d1flia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flia_ a.4.5.21 (A:) Fli-1 {Human (Homo sapiens) [TaxId: 9606]}
pgsgqiqlwqfllellsdsanascitwegtngefkmtdpdevarrwgerkskpnmnydkl
sralryyydknimtkvhgkryaykfdfhgiaqalqphp

SCOPe Domain Coordinates for d1flia_:

Click to download the PDB-style file with coordinates for d1flia_.
(The format of our PDB-style files is described here.)

Timeline for d1flia_: