SCOPe 2.04: Domain d2q02b_: 2q02 B:

Lineage for d2q02b_ (2q02 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.15: Xylose isomerase-like [51658] (8 families)
   different families share similar but non-identical metal-binding sites

5. Family c.1.15.4: IolI-like [75090] (3 proteins)

6. Protein Putative cytoplasmic protein STM4435 [159419] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [159420] (2 PDB entries)
   Uniprot Q8ZK48 1-271

8. Domain d2q02b_: 2q02 B: [161519]
   automated match to d2q02a1
   complexed with cl, unl, zn

Details for d2q02b_

PDB Entry: 2q02, 2.4 Å

PDB Description: crystal structure of a xylose isomerase domain containing protein (stm4435) from salmonella typhimurium lt2 at 2.40 a resolution

PDB Compounds: (B:) putative cytoplasmic protein

SCOPe Domain Sequences for d2q02b_:

Sequence; same for both SEQRES and ATOM records:

>d2q02b_ c.1.15.4 (B:) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]}
gmniektrfcinrkiapglsieaffrlvkrlefnkvelrndmpsgsvtddlnynqvrnla
ekygleivtinavypfnqlteevvkktegllrdaqgvgaralvlcplndgtivppevtve
aikrlsdlfarydiqglveplgfrvsslrsavwaqqlireagspfkvlldtfhhhlyeea
ekefasridisaiglvhlsgvedtrptealadeqrimlsekdvmqnyqqvqrlenmgyrg
iyafepfssqlaswseaeieeqinrsvslllq

Timeline for d2q02b_:

• d2q02b_ first appeared in SCOPe 2.01
  
• d2q02b_ appears in SCOPe 2.03
  
• d2q02b_ appears in SCOPe 2.05
  
• d2q02b_ appears in the current release, SCOPe 2.08, called d2q02b1