Lineage for d2q02a1 (2q02 A:1-271)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1575074Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 1575339Family c.1.15.4: IolI-like [75090] (3 proteins)
  6. 1575348Protein Putative cytoplasmic protein STM4435 [159419] (1 species)
  7. 1575349Species Salmonella typhimurium [TaxId:90371] [159420] (2 PDB entries)
    Uniprot Q8ZK48 1-271
  8. 1575350Domain d2q02a1: 2q02 A:1-271 [149978]
    complexed with cl, unl, zn

Details for d2q02a1

PDB Entry: 2q02 (more details), 2.4 Å

PDB Description: crystal structure of a xylose isomerase domain containing protein (stm4435) from salmonella typhimurium lt2 at 2.40 a resolution
PDB Compounds: (A:) putative cytoplasmic protein

SCOPe Domain Sequences for d2q02a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]}
mniektrfcinrkiapglsieaffrlvkrlefnkvelrndmpsgsvtddlnynqvrnlae
kygleivtinavypfnqlteevvkktegllrdaqgvgaralvlcplndgtivppevtvea
ikrlsdlfarydiqglveplgfrvsslrsavwaqqlireagspfkvlldtfhhhlyeeae
kefasridisaiglvhlsgvedtrptealadeqrimlsekdvmqnyqqvqrlenmgyrgi
yafepfssqlaswseaeieeqinrsvslllq

SCOPe Domain Coordinates for d2q02a1:

Click to download the PDB-style file with coordinates for d2q02a1.
(The format of our PDB-style files is described here.)

Timeline for d2q02a1: