Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.3: PG0945 N-terminal domain-like [159818] (1 protein) truncated to one domain; extra C-terminal region provides dimerisation interface |
Protein Uncharacterized protein PG0945 [159819] (1 species) putative ABC transporter, permease |
Species Porphyromonas gingivalis [TaxId:837] [159820] (1 PDB entry) Uniprot Q7MVU4 48-183 |
Domain d2p0sb_: 2p0s B: [161497] automated match to d2p0sa1 complexed with act, fmt, mg |
PDB Entry: 2p0s (more details), 1.6 Å
SCOPe Domain Sequences for d2p0sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p0sb_ c.94.1.3 (B:) Uncharacterized protein PG0945 {Porphyromonas gingivalis [TaxId: 837]} dmktiaiadrtgeyeqlfkendefrfvhaektaeeyrkmgadksgidavleirqdlledp navaiygykqlpasvsnhisrilsdylsdkkiasynipdikqiladskielsvhtykwse dg
Timeline for d2p0sb_: