SCOPe 2.08: Domain d2p0sb_: 2p0s B:

Lineage for d2p0sb_ (2p0s B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.3: PG0945 N-terminal domain-like [159818] (1 protein)
   truncated to one domain; extra C-terminal region provides dimerisation interface

6. Protein Uncharacterized protein PG0945 [159819] (1 species)
   putative ABC transporter, permease

7. Species Porphyromonas gingivalis [TaxId:837] [159820] (1 PDB entry)
   Uniprot Q7MVU4 48-183

8. Domain d2p0sb_: 2p0s B: [161497]
   automated match to d2p0sa1
   complexed with act, fmt, mg

Details for d2p0sb_

PDB Entry: 2p0s, 1.6 Å

PDB Description: Structural Genomics, the crystal structure of a putative ABC transporter domain from Porphyromonas gingivalis W83

PDB Compounds: (B:) ABC transporter, permease protein, putative

SCOPe Domain Sequences for d2p0sb_:

Sequence; same for both SEQRES and ATOM records:

>d2p0sb_ c.94.1.3 (B:) Uncharacterized protein PG0945 {Porphyromonas gingivalis [TaxId: 837]}
dmktiaiadrtgeyeqlfkendefrfvhaektaeeyrkmgadksgidavleirqdlledp
navaiygykqlpasvsnhisrilsdylsdkkiasynipdikqiladskielsvhtykwse
dg

Timeline for d2p0sb_:

• d2p0sb_ first appeared in SCOPe 2.01
  
• d2p0sb_ appears in SCOPe 2.07