Lineage for d2p0sa1 (2p0s A:48-183)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topology
Family c.94.1.3: PG0945 N-terminal domain-like [159818] (1 protein)
truncated to one domain; extra C-terminal region provides dimerisation interfaceProtein Uncharacterized protein PG0945 [159819] (1 species)
putative ABC transporter, permeaseSpecies Porphyromonas gingivalis [TaxId:837] [159820] (1 PDB entry)
Uniprot Q7MVU4 48-183
Domain d2p0sa1: 2p0s A:48-183 [149140]
complexed with act, fmt, mg
Details for d2p0sa1
PDB Entry: 2p0s (more details), 1.6 Å
PDB Description: Structural Genomics, the crystal structure of a putative ABC transporter domain from Porphyromonas gingivalis W83
PDB Compounds: (A:) ABC transporter, permease protein, putativeSCOPe Domain Sequences for d2p0sa1:
Sequence, based on SEQRES records: (download)
>d2p0sa1 c.94.1.3 (A:48-183) Uncharacterized protein PG0945 {Porphyromonas gingivalis [TaxId: 837]}
dmktiaiadrtgeyeqlfkendefrfvhaektaeeyrkmgadksgidavleirqdlledp
navaiygykqlpasvsnhisrilsdylsdkkiasynipdikqiladskielsvhtykwse
dgtnertsgelasgis
Sequence, based on observed residues (ATOM records): (download)
>d2p0sa1 c.94.1.3 (A:48-183) Uncharacterized protein PG0945 {Porphyromonas gingivalis [TaxId: 837]}
dmktiaiadrtgeyeqlfkendefrfvhaektaeeyrkmgadksgidavleirqdlledp
navaiygykqlpasvsnhisrilsdylsdkkiasynipdikqiladskielsvhtykwse
tsgelasgis
SCOPe Domain Coordinates for d2p0sa1:
Click to download the PDB-style file with coordinates for d2p0sa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2p0sa1:
- d2p0sa1 first appeared in SCOP 1.75
- d2p0sa1 appears in SCOPe 2.07
View in 3D
