PDB entry 2p0s

View 2p0s on RCSB PDB site
Description: Structural Genomics, the crystal structure of a putative ABC transporter domain from Porphyromonas gingivalis W83
Class: transport protein
Keywords: APC90123.1, putative ABC transporter, Porphyromonas gingivalis W83, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, TRANSPORT PROTEIN
Deposited on 2007-03-01, released 2007-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.179
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABC transporter, permease protein, putative
    Species: Porphyromonas gingivalis [TaxId:242619]
    Gene: PG_0945
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MVU4 (Start-142)
      • modified residue (8)
      • modified residue (45)
    Domains in SCOPe 2.07: d2p0sa1
  • Chain 'B':
    Compound: ABC transporter, permease protein, putative
    Species: Porphyromonas gingivalis [TaxId:242619]
    Gene: PG_0945
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MVU4
      • modified residue (8)
      • modified residue (45)
    Domains in SCOPe 2.07: d2p0sb_
  • Heterogens: MG, ACT, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p0sA (A:)
    snaqlggdmktiaiadrtgeyeqlfkendefrfvhaektaeeyrkmgadksgidavleir
    qdlledpnavaiygykqlpasvsnhisrilsdylsdkkiasynipdikqiladskielsv
    htykwsedgtnertsgelasgis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p0sA (A:)
    dmktiaiadrtgeyeqlfkendefrfvhaektaeeyrkmgadksgidavleirqdlledp
    navaiygykqlpasvsnhisrilsdylsdkkiasynipdikqiladskielsvhtykwse
    tsgelasgis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p0sB (B:)
    snaqlggdmktiaiadrtgeyeqlfkendefrfvhaektaeeyrkmgadksgidavleir
    qdlledpnavaiygykqlpasvsnhisrilsdylsdkkiasynipdikqiladskielsv
    htykwsedgtnertsgelasgis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p0sB (B:)
    dmktiaiadrtgeyeqlfkendefrfvhaektaeeyrkmgadksgidavleirqdlledp
    navaiygykqlpasvsnhisrilsdylsdkkiasynipdikqiladskielsvhtykwse
    dg