Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.46: YhhF-like [142611] (6 proteins) Pfam PF03602 |
Protein Putative methylase HI0767 [142616] (1 species) YhhF homologue |
Species Haemophilus influenzae [TaxId:727] [142617] (1 PDB entry) Uniprot P44869 11-193 |
Domain d2iftb_: 2ift B: [161462] automated match to d2ifta1 |
PDB Entry: 2ift (more details), 2.3 Å
SCOPe Domain Sequences for d2iftb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iftb_ c.66.1.46 (B:) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} ptgdrvketlfnwlmpyihqsecldgfagsgslgfealsrqakkvtfleldktvanqlkk nlqtlkcsseqaevinqssldflkqpqnqphfdvvfldppfhfnlaeqaisllcennwlk pnaliyvetekdkplitpenwtllkekttgivsyrlyqnle
Timeline for d2iftb_: