SCOPe 2.01: Domain d2iftb_: 2ift B:

Lineage for d2iftb_ (2ift B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.46: YhhF-like [142611] (6 proteins)
   Pfam PF03602

6. Protein Putative methylase HI0767 [142616] (1 species)
   YhhF homologue

7. Species Haemophilus influenzae [TaxId:727] [142617] (1 PDB entry)
   Uniprot P44869 11-193

8. Domain d2iftb_: 2ift B: [161462]
   automated match to d2ifta1

Details for d2iftb_

PDB Entry: 2ift, 2.3 Å

PDB Description: Crystal structure of putative methylase HI0767 from Haemophilus influenzae. NESG target IR102.

PDB Compounds: (B:) Putative methylase HI0767

SCOPe Domain Sequences for d2iftb_:

Sequence; same for both SEQRES and ATOM records:

>d2iftb_ c.66.1.46 (B:) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]}
ptgdrvketlfnwlmpyihqsecldgfagsgslgfealsrqakkvtfleldktvanqlkk
nlqtlkcsseqaevinqssldflkqpqnqphfdvvfldppfhfnlaeqaisllcennwlk
pnaliyvetekdkplitpenwtllkekttgivsyrlyqnle

Timeline for d2iftb_:

• d2iftb_ is new in SCOPe 2.01-stable
  
• d2iftb_ appears in SCOPe 2.02
  
• d2iftb_ appears in the current release, SCOPe 2.08, called d2iftb1