Lineage for d2gtpc_ (2gtp C:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1092942Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 1092943Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 1092999Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 1093000Protein automated matches [190464] (1 species)
    not a true protein
  7. 1093001Species Human (Homo sapiens) [TaxId:9606] [187381] (5 PDB entries)
  8. 1093008Domain d2gtpc_: 2gtp C: [161442]
    Other proteins in same PDB: d2gtpa1, d2gtpa2, d2gtpb1, d2gtpb2
    automated match to d2jm5a1
    complexed with alf, gdp, mg

Details for d2gtpc_

PDB Entry: 2gtp (more details), 2.55 Å

PDB Description: Crystal structure of the heterodimeric complex of human RGS1 and activated Gi alpha 1
PDB Compounds: (C:) Regulator of G-protein signaling 1

SCOPe Domain Sequences for d2gtpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtpc_ a.91.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlsaaevmqwsqslekllanqtgqnvfgsflksefseeniefwlacedykktesdllpck
aeeiykafvhsdaakqinidfrtrestakkikaptptcfdeaqkviytlmekdsyprflk
sdiylnllndlq

SCOPe Domain Coordinates for d2gtpc_:

Click to download the PDB-style file with coordinates for d2gtpc_.
(The format of our PDB-style files is described here.)

Timeline for d2gtpc_: