Lineage for d2gtpa2 (2gtp A:32-60,A:182-348)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163638Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1164431Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 1164453Species Human (Homo sapiens) [TaxId:9606] [159560] (7 PDB entries)
  8. 1164458Domain d2gtpa2: 2gtp A:32-60,A:182-348 [135679]
    Other proteins in same PDB: d2gtpa1, d2gtpb1, d2gtpc_, d2gtpd_
    automatically matched to d1kjya2
    complexed with alf, gdp, mg

Details for d2gtpa2

PDB Entry: 2gtp (more details), 2.55 Å

PDB Description: Crystal structure of the heterodimeric complex of human RGS1 and activated Gi alpha 1
PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d2gtpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtpa2 c.37.1.8 (A:32-60,A:182-348) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
revkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkw
ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
vqfvfdavtdviiknnl

SCOPe Domain Coordinates for d2gtpa2:

Click to download the PDB-style file with coordinates for d2gtpa2.
(The format of our PDB-style files is described here.)

Timeline for d2gtpa2: