Class g: Small proteins [56992] (100 folds) |
Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) conserved core consists of a helix and a loop crosslinked with two disulfides |
Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins) |
Protein automated matches [190305] (3 species) not a true protein |
Species Turkey (Meleagris gallopavo) [TaxId:9103] [187118] (3 PDB entries) |
Domain d2gkva_: 2gkv A: [161431] Other proteins in same PDB: d2gkve_ automated match to d1omta_ |
PDB Entry: 2gkv (more details), 1.7 Å
SCOPe Domain Sequences for d2gkva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gkva_ g.68.1.1 (A:) automated matches {Turkey (Meleagris gallopavo) [TaxId: 9103]} vdcseypkpactleyrplcgsdnktyankcnfcnavvesngtltlshfgkc
Timeline for d2gkva_: