Lineage for d2gkvb_ (2gkv B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038435Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 3038436Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 3038437Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 3038536Protein automated matches [190305] (3 species)
    not a true protein
  7. 3038544Species Turkey (Meleagris gallopavo) [TaxId:9103] [187118] (3 PDB entries)
  8. 3038548Domain d2gkvb_: 2gkv B: [161432]
    Other proteins in same PDB: d2gkve_
    automated match to d1omta_

Details for d2gkvb_

PDB Entry: 2gkv (more details), 1.7 Å

PDB Description: crystal structure of the sgpb:p14'-ala32 omtky3-del(1-5) complex
PDB Compounds: (B:) Ovomucoid

SCOPe Domain Sequences for d2gkvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gkvb_ g.68.1.1 (B:) automated matches {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vdcseypkpactleyrplcgsdnktyankcnfcnavvesngtltlshfgkc

SCOPe Domain Coordinates for d2gkvb_:

Click to download the PDB-style file with coordinates for d2gkvb_.
(The format of our PDB-style files is described here.)

Timeline for d2gkvb_: