SCOPe 2.07: Domain d2bkid_: 2bki D:

Lineage for d2bkid_ (2bki D:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (14 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47520] (10 PDB entries)
   mutant with a two residue deletion in the central helix

8. Domain d2bkid_: 2bki D: [161391]
   automated match to d1cfca_
   complexed with ca, so4

Details for d2bkid_

PDB Entry: 2bki, 2.9 Å

PDB Description: myosin vi nucleotide-free (mdinsert2-iq) crystal structure

PDB Compounds: (D:) calmodulin

SCOPe Domain Sequences for d2bkid_:

Sequence, based on SEQRES records:

>d2bkid_ a.39.1.5 (D:) Calmodulin {Chicken (Gallus gallus) [TaxId: 9031]}
eeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtidf
pefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemi

Sequence, based on observed residues (ATOM records):

>d2bkid_ a.39.1.5 (D:) Calmodulin {Chicken (Gallus gallus) [TaxId: 9031]}
eeqiaefkeafpteaelqdmiltmmarkmkdtdseeeireafrvfdkdgngyisaaelrh
vmtnlgekltdeevdemi

Timeline for d2bkid_:

• d2bkid_ first appeared in SCOPe 2.01
  
• d2bkid_ appears in SCOPe 2.06
  
• d2bkid_ appears in the current release, SCOPe 2.08