| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein Calmodulin [47516] (11 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [47520] (7 PDB entries) mutant with a two residue deletion in the central helix |
| Domain d2bkid_: 2bki D: [161391] automated match to d1cfca_ complexed with ca, so4 |
PDB Entry: 2bki (more details), 2.9 Å
SCOPe Domain Sequences for d2bkid_:
Sequence, based on SEQRES records: (download)
>d2bkid_ a.39.1.5 (D:) Calmodulin {Chicken (Gallus gallus) [TaxId: 9031]}
eeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtidf
pefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemi
>d2bkid_ a.39.1.5 (D:) Calmodulin {Chicken (Gallus gallus) [TaxId: 9031]}
eeqiaefkeafpteaelqdmiltmmarkmkdtdseeeireafrvfdkdgngyisaaelrh
vmtnlgekltdeevdemi
Timeline for d2bkid_: