Lineage for d2b4sc_ (2b4s C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1167639Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 1167640Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 1167712Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 1167744Protein Tyrosine phosphatase [52806] (7 species)
  7. 1167745Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (97 PDB entries)
    Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299
  8. 1167806Domain d2b4sc_: 2b4s C: [161389]
    Other proteins in same PDB: d2b4sb_, d2b4sd_
    automated match to d1eena_
    complexed with so4

Details for d2b4sc_

PDB Entry: 2b4s (more details), 2.3 Å

PDB Description: crystal structure of a complex between ptp1b and the insulin receptor tyrosine kinase
PDB Compounds: (C:) Tyrosine-protein phosphatase, non-receptor type 1

SCOPe Domain Sequences for d2b4sc_:

Sequence, based on SEQRES records: (download)

>d2b4sc_ c.45.1.2 (C:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhasagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim

Sequence, based on observed residues (ATOM records): (download)

>d2b4sc_ c.45.1.2 (C:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmslkcaqy
wpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdfgv
pespasflnflfkvresgslspehgpvvvhasagigrsgtfcladtclllmdkrkdpssv
dikkvllemrkfrmgliqtadqlrfsylaviegakfim

SCOPe Domain Coordinates for d2b4sc_:

Click to download the PDB-style file with coordinates for d2b4sc_.
(The format of our PDB-style files is described here.)

Timeline for d2b4sc_: