SCOPe 2.08: Domain d2b4sc_: 2b4s C:

Lineage for d2b4sc_ (2b4s C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (7 species)

7. Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (268 PDB entries)
   Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299

8. Domain d2b4sc_: 2b4s C: [161389]
   Other proteins in same PDB: d2b4sb_, d2b4sd_
   automated match to d1eena_
   complexed with so4

Details for d2b4sc_

PDB Entry: 2b4s, 2.3 Å

PDB Description: crystal structure of a complex between ptp1b and the insulin receptor tyrosine kinase

PDB Compounds: (C:) Tyrosine-protein phosphatase, non-receptor type 1

SCOPe Domain Sequences for d2b4sc_:

Sequence, based on SEQRES records:

>d2b4sc_ c.45.1.2 (C:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhasagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim

Sequence, based on observed residues (ATOM records):

>d2b4sc_ c.45.1.2 (C:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmslkcaqy
wpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdfgv
pespasflnflfkvresgslspehgpvvvhasagigrsgtfcladtclllmdkrkdpssv
dikkvllemrkfrmgliqtadqlrfsylaviegakfim

Timeline for d2b4sc_:

• d2b4sc_ first appeared in SCOPe 2.01
  
• d2b4sc_ appears in SCOPe 2.07