![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
![]() | Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
![]() | Protein Tyrosine phosphatase [52806] (7 species) |
![]() | Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (268 PDB entries) Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299 |
![]() | Domain d2b4sc_: 2b4s C: [161389] Other proteins in same PDB: d2b4sb_, d2b4sd_ automated match to d1eena_ complexed with so4 |
PDB Entry: 2b4s (more details), 2.3 Å
SCOPe Domain Sequences for d2b4sc_:
Sequence, based on SEQRES records: (download)
>d2b4sc_ c.45.1.2 (C:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd fgvpespasflnflfkvresgslspehgpvvvhasagigrsgtfcladtclllmdkrkdp ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim
>d2b4sc_ c.45.1.2 (C:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmslkcaqy wpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdfgv pespasflnflfkvresgslspehgpvvvhasagigrsgtfcladtclllmdkrkdpssv dikkvllemrkfrmgliqtadqlrfsylaviegakfim
Timeline for d2b4sc_: