Lineage for d1znvd_ (1znv D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1015556Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 1015557Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 1015558Family d.4.1.1: HNH-motif [54061] (3 proteins)
  6. 1015559Protein DNase domain of colicin E7 [54062] (1 species)
  7. 1015560Species Escherichia coli [TaxId:562] [54063] (10 PDB entries)
  8. 1015565Domain d1znvd_: 1znv D: [161374]
    Other proteins in same PDB: d1znva_, d1znvc_
    automated match to d1mz8b_
    protein/DNA complex; complexed with ni, po4

Details for d1znvd_

PDB Entry: 1znv (more details), 2 Å

PDB Description: how a his-metal finger endonuclease cole7 binds and cleaves dna with a transition metal ion cofactor
PDB Compounds: (D:) colicin e7

SCOPe Domain Sequences for d1znvd_:

Sequence, based on SEQRES records: (download)

>d1znvd_ d.4.1.1 (D:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelheekpisqnggvydmdnisvvtpkrh
idihrgk

Sequence, based on observed residues (ATOM records): (download)

>d1znvd_ d.4.1.1 (D:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelheevydmdnisvvtpkrhidihrgk

SCOPe Domain Coordinates for d1znvd_:

Click to download the PDB-style file with coordinates for d1znvd_.
(The format of our PDB-style files is described here.)

Timeline for d1znvd_: