SCOPe 2.01: Domain d1znvb_: 1znv B:

Lineage for d1znvb_ (1znv B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (3 proteins)

6. Protein DNase domain of colicin E7 [54062] (1 species)

7. Species Escherichia coli [TaxId:562] [54063] (10 PDB entries)

8. Domain d1znvb_: 1znv B: [161373]
   Other proteins in same PDB: d1znva_, d1znvc_
   automated match to d1mz8b_
   protein/DNA complex; complexed with ni, po4

Details for d1znvb_

PDB Entry: 1znv, 2 Å

PDB Description: how a his-metal finger endonuclease cole7 binds and cleaves dna with a transition metal ion cofactor

PDB Compounds: (B:) colicin e7

SCOPe Domain Sequences for d1znvb_:

Sequence, based on SEQRES records:

>d1znvb_ d.4.1.1 (B:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelheekpisqnggvydmdnisvvtpkrh
idihrgk

Sequence, based on observed residues (ATOM records):

>d1znvb_ d.4.1.1 (B:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelheevydmdnisvvtpkrhidihrgk

Timeline for d1znvb_:

• d1znvb_ is new in SCOPe 2.01-stable
  
• d1znvb_ appears in SCOPe 2.02
  
• d1znvb_ appears in the current release, SCOPe 2.08