Lineage for d1f1zb1 (1f1z B:169-267)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351617Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) (S)
    contains a small beta-sheet (wing)
  5. 351981Family a.4.5.27: TnsA endonuclease, C-terminal domain [46782] (1 protein)
  6. 351982Protein TnsA endonuclease, C-terminal domain [46783] (1 species)
  7. 351983Species Escherichia coli [TaxId:562] [46784] (1 PDB entry)
  8. 351985Domain d1f1zb1: 1f1z B:169-267 [16082]
    Other proteins in same PDB: d1f1za2, d1f1zb2
    complexed with cl, mg

Details for d1f1zb1

PDB Entry: 1f1z (more details), 2.4 Å

PDB Description: tnsa, a catalytic component of the tn7 transposition system

SCOP Domain Sequences for d1f1zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1zb1 a.4.5.27 (B:169-267) TnsA endonuclease, C-terminal domain {Escherichia coli}
npvvkeniewlysvkteevsaellaqlsplahilqekgdeniinvckqvdiaydlelgkt
lseiraltangfikfniyksfrankcadlcisqvvnmee

SCOP Domain Coordinates for d1f1zb1:

Click to download the PDB-style file with coordinates for d1f1zb1.
(The format of our PDB-style files is described here.)

Timeline for d1f1zb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f1zb2