Lineage for d1pdnc_ (1pdn C:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 210246Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 210247Superfamily a.4.1: Homeodomain-like [46689] (11 families) (S)
    consists only of helices
  5. 210429Family a.4.1.5: Paired domain [46748] (3 proteins)
    duplication: consists of two domains of this fold
  6. 210430Protein Paired protein (prd) [46751] (1 species)
  7. 210431Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46752] (1 PDB entry)
  8. 210432Domain d1pdnc_: 1pdn C: [16047]
    protein/DNA complex

Details for d1pdnc_

PDB Entry: 1pdn (more details), 2.5 Å

PDB Description: crystal structure of a paired domain-dna complex at 2.5 angstroms resolution reveals structural basis for pax developmental mutations

SCOP Domain Sequences for d1pdnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster)}
qgrvnqlggvfingrplpnnirlkivemaadgirpcvisrqlrvshgcvskilnryqetg
sirpgviggskpriatpeienrieeykrsspgmfsweirekliregvcdrstapsvsais
rlv

SCOP Domain Coordinates for d1pdnc_:

Click to download the PDB-style file with coordinates for d1pdnc_.
(The format of our PDB-style files is described here.)

Timeline for d1pdnc_: