Class a: All alpha proteins [46456] (179 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (11 families) consists only of helices |
Family a.4.1.5: Paired domain [46748] (3 proteins) duplication: consists of two domains of this fold |
Protein Paired protein (prd) [46751] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46752] (1 PDB entry) |
Domain d1pdnc_: 1pdn C: [16047] protein/DNA complex |
PDB Entry: 1pdn (more details), 2.5 Å
SCOP Domain Sequences for d1pdnc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster)} qgrvnqlggvfingrplpnnirlkivemaadgirpcvisrqlrvshgcvskilnryqetg sirpgviggskpriatpeienrieeykrsspgmfsweirekliregvcdrstapsvsais rlv
Timeline for d1pdnc_: