Lineage for d1msec2 (1mse C:144-193)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351237Superfamily a.4.1: Homeodomain-like [46689] (12 families) (S)
    consists only of helices
  5. 351392Family a.4.1.3: Myb/SANT domain [46739] (5 proteins)
  6. 351397Protein c-Myb, DNA-binding domain [46740] (1 species)
    duplication
  7. 351398Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries)
  8. 351415Domain d1msec2: 1mse C:144-193 [16040]
    repeats 2 & 3
    protein/DNA complex

Details for d1msec2

PDB Entry: 1mse (more details)

PDB Description: solution structure of a specific dna complex of the myb dna-binding domain with cooperative recognition helices

SCOP Domain Sequences for d1msec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1msec2 a.4.1.3 (C:144-193) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
ktswteeedriiyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv

SCOP Domain Coordinates for d1msec2:

Click to download the PDB-style file with coordinates for d1msec2.
(The format of our PDB-style files is described here.)

Timeline for d1msec2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1msec1